PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_33480_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 315aa    MW: 35239 Da    PI: 6.0995
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_33480_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.52.3e-111988148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT......................TTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg......................kgRtlkqcksrwqkyl 48
                                          rg+WT+eEd +++ +v ++G g+W++++++ g                      + R +k+c++rw +yl
  cra_locus_33480_iso_2_len_1166_ver_3 19 RGPWTAEEDAKILAYVSRHGIGNWTLVPQKAGkfsttikdilrxslilrsssagLDRWGKSCRLRWTNYL 88
                                          89******************************99999999999999999999***************997 PP

2Myb_DNA-binding51.13e-1695137246
                                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           +++T+eE+e +++++k  G++ W++Ia+ ++ gRt++++k++w++
  cra_locus_33480_iso_2_len_1166_ver_3  95 DNFTPEEEESILELHKTIGSR-WSLIAKQLP-GRTDNDVKNYWNT 137
                                           68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-211091IPR009057Homeodomain-like
PROSITE profilePS5129412.9121468IPR017930Myb domain
SuperFamilySSF466896.87E-2716135IPR009057Homeodomain-like
SMARTSM007177.5E-91890IPR001005SANT/Myb domain
PfamPF002492.9E-101988IPR001005SANT/Myb domain
CDDcd001673.94E-72188No hitNo description
PROSITE profilePS5129422.89289143IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-2592144IPR009057Homeodomain-like
SMARTSM007179.7E-1593141IPR001005SANT/Myb domain
CDDcd001671.28E-1196139No hitNo description
PfamPF002499.5E-1596137IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
SHTLMMGRPP CCDKANVKRG PWTAEEDAKI LAYVSRHGIG NWTLVPQKAG KFSTTIKDIL  60
RXSLILRSSS AGLDRWGKSC RLRWTNYLRP DLNHDNFTPE EEESILELHK TIGSRWSLIA  120
KQLPGRTDND VKNYWNTKLK KKLINMGIDP ITHKPISQII TEFEKISGLP NTRRTHNGFS  180
QNEPFPVQMM EVSEQNHFSW GTSSSSSQFQ SINHPVAAAA SSSSTSNDYF LVDPYLAIGK  240
EEDCELQGIL SSNNSSVSMD VTGNQNDAGT SSCYQQISEI NNNSSEDSSF VDSILARDSE  300
ILLDFPQLSG GYFDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26191437108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016441905.19e-97PREDICTED: transcription factor MYB35-like
TrEMBLM1AG012e-94M1AG01_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000220095e-94(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154